SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013285612.1.11406 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013285612.1.11406
Domain Number 1 Region: 1-401
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 7.07e-82
Family Gtf glycosyltransferase 0.0000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013285612.1.11406
Sequence length 407
Comment MULTISPECIES: glycosyl transferase [Micromonospora]; AA=GCF_000177655.2; RF=na; TAX=648999; STAX=648999; NAME=Micromonospora sp. L5; strain=L5; AL=Complete Genome; RT=Major
Sequence
MRVLLSTLGSRGDVQPLVALASRLTALGHQVRLCAPPDFARWVASFRIPFVPVGPPWRRS
AAPRSRAAVPKPSPAQVRKLAESSIGIQFEVLSAAARDCDVLVASTGLQIAARTVAEKRG
IPYVFAALCPAALPSPHHPPLPLPVFGEVPAPASADNSDLWAANLRHVNDTFAAPLNALR
SAVGLGTVDDVSDHIHTDRPWLATDPTLAPWPDVADPAVYQPGAWLLPDKRALPAELTAF
LDAGGPCVYVGFGSVAAPPGLLETAVRAVRAVGCRLVVSRGWAPLSPVDRSPDCLVVGEV
NQQDLFREVAVVVHHGGAGTTTTAARAGTPQVVVPQVYDQHYFARRVSALGIGTAHPGSV
PTVESLTEALGAALRPEVAARAREFAGVVRTDAAQVAAERLVVAPGA
Download sequence
Identical sequences A0A1S1WDJ4 D9T6U3
WP_013285612.1.11406 WP_013285612.1.81987 WP_013285612.1.89352 gi|302866922|ref|YP_003835559.1| gi|315506640|ref|YP_004085527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]