SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013291649.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013291649.1.47838
Domain Number 1 Region: 683-798
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.14e-20
Family Cellulose-binding domain family III 0.011
Further Details:      
 
Weak hits

Sequence:  WP_013291649.1.47838
Domain Number - Region: 813-865
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00147
Family Type I dockerin domain 0.0069
Further Details:      
 
Domain Number - Region: 157-221
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.0824
Family STM3548-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013291649.1.47838
Sequence length 872
Comment hypothetical protein [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MKSKKRICTLLVAMFMFLVFVSPNVAYAEVGTTQATPTLTATPNNEGNYISLKWTAPDPS
KSYSYMIYSKKSTEAEFQSIPAKGTVKALNIYPNPVSNTGLSGGEKDLDGNSIPDSGILK
TWLAKENINTITIESVSLTSFNSNPSKYLAKSNGKWNYDSVFYGMWNLDPQNMYPNDTAI
EYLRTFINDGGGFMTSHHTIGYMGLDRGVNKLAKELGVEIFGRAQANIIQPYTCRDANGH
LFPTVSFEVDDPSSTANADCTSYWNSSTKVQLGKSGLLNNYPFKVGNIGDTFDIPYQHGL
SVFGKGDIWMTSVNPLGFVGIPFKEITISPSTGAKGTNNFYLHTYNNTAIINSGHSFPQI
TQAETRIIANTLYYLSQVTNQTSWDDHKGQDVDSPTKPNITRVAVDKAANKTNITFEPST
DKGTIYDYYIQAKELITSNKTNSEVKSTTITSGLKGYSIVVDKNPSTIPGNTITTTSPSY
SVNGAFTEDCYIHVAAVDNVGNVSEVSHYKYTNPVLSMTLTPSTTELQRDPVTIIAVATS
TNIAIAKIQTPDGNWVDGATANYDVNENGDYKFTAVDELGNQITQSITISNIIPKPVLSL
ALTPSITADTNGPVTISATATSTNTKIIKVQTPDGKWVDGSTVDYVVSSNGTYKFTAVDE
LGYEVTESVEVNNIFKVVLNVEPERNRIHLNETVTANLTIDNIKEIAAEDIRIKYDTTKL
QFLGYEQVDGIKLMKSSSQNGELRFILVSKGLLNVVNSKTILLKLKFKGIAPGDGLVDVT
KGRVSDGILMEKNLKDVECGQVNINVADEELIDVNADDEFSLLDLGILGRHLGEDPADLP
EYNADVVLNDAIDDEDLAEVVKFMLLNPNYNF
Download sequence
Identical sequences D9SUN1
gi|302874067|ref|YP_003842700.1| WP_013291649.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]