SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013291664.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013291664.1.47838
Domain Number 1 Region: 62-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-19
Family CBM4/9 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013291664.1.47838
Sequence length 205
Comment carbohydrate-binding protein [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MGLQFMKKKFKTAVAAVVLASSVTGYNIAKEDDIVALDLKKSSLESMDYSKEKIEDISEN
LVKYGTFSESPECFKHWRVVVDNIAICTYENSNDVFSLEPEDCGNSEDAIQLCQTIDNIE
PGKKYTLNFKAKSTLPKSITVFISDRMDVLSFSKPATYSISDKWTDYTYDFVVSENTEPL
SVLRFYLGRTMGKISFTDIKLNLSS
Download sequence
Identical sequences D9SVH1
gi|302874226|ref|YP_003842859.1| WP_013291664.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]