SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013291798.1.47838 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013291798.1.47838
Domain Number 1 Region: 35-665
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 7.29e-301
Family Cellulases catalytic domain 0.000000000000112
Further Details:      
 
Domain Number 2 Region: 670-726
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.97e-16
Family Type I dockerin domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013291798.1.47838
Sequence length 727
Comment endoglucanase [Clostridium cellulovorans]; AA=GCF_000145275.1; RF=representative genome; TAX=573061; STAX=1493; NAME=Clostridium cellulovorans 743B; strain=743B; AL=Complete Genome; RT=Major
Sequence
MRKRLNKIVAVALTATTISSVAATVNTAQVSAAPVVPNNEYVQHFKDMYAKIHNANNGYF
SDEGIPYHAVETLMVEAPDYGHETTSEAFSYYMWLEAMNAKLTGDFSGFKKAWDVTEKYI
IPGETDQPSASMSNYDPNKPATYAAEHPDPSMYPSQLQFGAAVGKDPLYNELKSTYGTSQ
VYGMHWLLDVDNWYGFGGATSTSPVYINTFQRGVQESCWETVPQPCKDEMKYGGRNGFLD
LFTGDSQYATQFKYTNAPDADARAVQATYYAQLAAKEWGVDISSYVAKSTKMGDFLRYSF
FDKYFRKVGNSTQAGTGYDSAQYLLNWYYAWGGGISSNWSWRIGSSHNHFGYQNPMAAWI
LSNTSDFKPKSPNAATDWNNSLKRQIEFYQWLQSAEGGIAGGASNSNGGSYQAWPAGTAT
FYGMGYTPHPVYEDPGSNEWFGMQAWSMQRVAEYYYSSKDPAAKSLLDKWAKWACANVQF
DDAAKKFKIPAKLVWTGQPDTWTGSYTGNSNLHVKVEAYGEDLGVAGSLSNALSYYAKAL
ESSTDAADKVAYNTAKETSRKILDYLWASYQDDKGIAVTETRNDFKRFNQSVYIPSGWTG
KMPNGDVIQSGATFLSIRSKYKQDPSWPKVEAALANGTGVDMTYHRFWGQSDIAIAFGTY
GTLFTDPTPGLKGDVNSDAKVNAIDLAILKKYILDSTTKINTANSDMNGDGKVNAMDLAL
LKKALLA
Download sequence
Identical sequences D9SS72
WP_013291798.1.47838 gi|302875650|ref|YP_003844283.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]