SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013325173.1.91546 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013325173.1.91546
Domain Number - Region: 10-90
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00497
Family FCH domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013325173.1.91546
Sequence length 133
Comment hypothetical protein [Cyanothece sp. PCC 7822]; AA=GCF_000147335.1; RF=na; TAX=497965; STAX=497965; NAME=Cyanothece sp. PCC 7822; strain=PCC 7822; AL=Complete Genome; RT=Major
Sequence
MSHSSPNPLNDYGEEFEQDLAKAEQALEKLKQRYALILEQSQRQAELHEQRSLSEQAWQN
HPTPELEVELRQIEAQIQELQLTLESALLSSDDLKRLFWQGLRSGLLSELFWQIVRFGGI
GIIIGWILKSCSK
Download sequence
Identical sequences E0U626
gi|307155026|ref|YP_003890410.1| WP_013325173.1.91546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]