SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013328298.1.58734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013328298.1.58734
Domain Number 1 Region: 147-222
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000102
Family Transglutaminase, two C-terminal domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013328298.1.58734
Sequence length 425
Comment hypothetical protein [Methanolacinia petrolearia]; AA=GCF_000147875.1; RF=representative genome; TAX=679926; STAX=54120; NAME=Methanolacinia petrolearia DSM 11571; AL=Complete Genome; RT=Major
Sequence
MKRINIFLILLVLFAAIPFIAAADDSEDSSYTDVTVTSVEYDPEVFMPGDEGTITITVKN
TGDESVTISRAEIYSQDVTNLNDEAYDTVGALGAGNSMEFTFNVKAPLKEGIYYPRFYLD
FYGSSGLSYNVPVKVDDTGLTISVINSPDAWQEDVSKSIQIRVGNPSQVTADGVIIYASG
DGIESDQTSFFVGALEPNEYVDVTFEITPSKETTLKLNAEWNNGMNSHTSEISVPVEFGE
DTTGADLVINNVEVSGGTVTGDVSNAGLEDAYSVIVTVGSPAEAIEPYKQYVLGSLESDD
FSSFEVTYSIQGSSSSFPLVITWKDENGNTYSSEYTVSASSSGMAVEGDDSASSGGAPSG
MGSGGPSGGGMGMMGMSGAGFANMPIAEIIIGLIIVIGLVVAWKKGYLAKAVKVVKEKLN
KGDRK
Download sequence
Identical sequences E1RFW7
WP_013328298.1.58734 gi|307352506|ref|YP_003893557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]