SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013330083.1.58734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013330083.1.58734
Domain Number 1 Region: 145-238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000894
Family I set domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013330083.1.58734
Sequence length 337
Comment hypothetical protein [Methanolacinia petrolearia]; AA=GCF_000147875.1; RF=representative genome; TAX=679926; STAX=54120; NAME=Methanolacinia petrolearia DSM 11571; AL=Complete Genome; RT=Major
Sequence
MNSKIISLLIISAAIFCVICPVQADAGQSEQITITASGDRSYYSDEMITFSGTNTGSDYV
YLFITGPNLNENGSRPDEPGTAAGTGNVNTFSRAAVADNDTWKYKLFNATDFEPGTYTVF
AVTEPNNMKDLSKGTYDSVSIAIKKPFITVQVSEPVVQRGEELVITGSASWMPHSVAIWV
LGFNYWNGAENGSMVTVIPEDDGSYSYVLDGNETAKMEDGKYYVIAQHPMYNDEFNVIIE
DDSSGDGVLVTGIRTDSPEENGSGFYIGGNYALRGADAAEALIEEIDSADIDDTYDKCEF
EIKGQVENGQSGNNQPDKNTDNSILAAIGNLFVGISG
Download sequence
Identical sequences E1RK93
gi|307354293|ref|YP_003895344.1| WP_013330083.1.58734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]