SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013335486.1.43420 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013335486.1.43420
Domain Number 1 Region: 67-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000894
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  WP_013335486.1.43420
Domain Number - Region: 41-63
Classification Level Classification E-value
Superfamily TBP-interacting protein-like 0.000366
Family TBP-interacting protein-like 0.0061
Further Details:      
 
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0186
Family Rubredoxin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013335486.1.43420
Sequence length 130
Comment hypothetical protein [Vulcanisaeta distributa]; AA=GCF_000148385.1; RF=na; TAX=572478; STAX=164451; NAME=Vulcanisaeta distributa DSM 14429; strain=DSM 14429; AL=Complete Genome; RT=Major
Sequence
MSTAAKALTKIVVCPLCDYMGEDVNKVVDAITKASPRPKLKCPKCGAEVDVNSFVTHMRR
HGRVGGKTITCEICNAKLNGEGAFLRHIKEHLIVSVRRNGMDIYYCLVCGQEFITKNSAI
THLIKRHSLE
Download sequence
Identical sequences E1QTP6
gi|307594495|ref|YP_003900812.1| WP_013335486.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]