SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013336591.1.43420 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013336591.1.43420
Domain Number - Region: 3-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000446
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013336591.1.43420
Sequence length 68
Comment hypothetical protein [Vulcanisaeta distributa]; AA=GCF_000148385.1; RF=na; TAX=572478; STAX=164451; NAME=Vulcanisaeta distributa DSM 14429; strain=DSM 14429; AL=Complete Genome; RT=Major
Sequence
MPTCKLCGRSFDTLTELYVHLSSECNKIPRSRRCPVCGSKYRSIRFMKHHLINEAFIESK
HMSYLISI
Download sequence
Identical sequences E1QSZ9
gi|307595600|ref|YP_003901917.1| WP_013336591.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]