SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013353856.1.1127 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013353856.1.1127
Domain Number - Region: 31-121
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000942
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013353856.1.1127
Sequence length 183
Comment MULTISPECIES: hypothetical protein [Bacillus subtilis group]; AA=GCF_000196735.1; RF=representative genome; TAX=692420; STAX=1390; NAME=Bacillus amyloliquefaciens DSM 7; strain=DSM 7; AL=Complete Genome; RT=Major
Sequence
MLLPEEFNRSWDVNKNGPLLTFPYDDLVETPFSEGFKKFISLGGLPESPPPYLDFTSFPA
SFKPITSIFDVSEGFQKYWLLGSTGSGDPICIIENNERIVYLDNGNEYKEVFINSSINQF
AECILLFSEMIDKAIHINGEDAFIDNDIPEYVIEWLKEELKRVDSNCTREGSFWGTEIEN
LYE
Download sequence
Identical sequences A0A0A0U027 A0A1Y0XKL1
gi|384170333|ref|YP_005551711.1| gi|308175353|ref|YP_003922058.1| gi|384161237|ref|YP_005543310.1| WP_013353856.1.1127 WP_013353856.1.1325 WP_013353856.1.33972 WP_013353856.1.54561 WP_013353856.1.65712 WP_013353856.1.70207 WP_013353856.1.70510 WP_013353856.1.80835 gi|384166138|ref|YP_005547517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]