SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013369105.1.14980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013369105.1.14980
Domain Number 1 Region: 327-464
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.85e-18
Family Histidine kinase 0.009
Further Details:      
 
Domain Number 2 Region: 256-339
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000124
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Domain Number 3 Region: 215-262
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000693
Family HAMP domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013369105.1.14980
Sequence length 476
Comment two-component sensor histidine kinase [Paenibacillus polymyxa]; AA=GCF_000164985.3; RF=representative genome; TAX=886882; STAX=1406; NAME=Paenibacillus polymyxa SC2; strain=SC2; AL=Complete Genome; RT=Minor
Sequence
MNGMRKRWTGLHLNSRPGQGGRFRNSLLFRYLVIIVFAMVLLPIVLPVTTLIYSILLNLQ
TDIKPTNPYYPSTTHTENSWHREAIALKGANPEQVSAHLRKIQQNMFPDSQIFWVDTAGL
TRLELPTQPNIPKQWSAAQAIAFMKQASYDGPFTVVAFIGGGKDDVNQGYMVLKVPRSFF
EQSSTDNGMLMYYLLFILLVLGAFIFVSLLFFGGIRRRLLQLQAAMSQRGEDGLPILVAT
GRPDEIGKLEEAFNRMVEQLAESRGRERQEEELRKRLVADLSHDIRTPLTVVRSHLYTLD
AENLSSRGKQSITLMENKLKDLGSLIDNLLTYNLLSSGKYTMNNEPRDILRLVRECAASW
YPVWEKEGFEVDIDLPEHSMVWNVDEQGFRRLLDNLFQNVVRHAASGRYIGIQVQKVNGR
EALVIADKGPGMERQSSEKGAGIGLAITELLAREMNLEREICSSSAGTRICFLNKT
Download sequence
Identical sequences E3EDA8
gi|386039139|ref|YP_005958093.1| WP_013369105.1.14980 WP_013369105.1.31500 WP_013369105.1.91857 gi|310639948|ref|YP_003944706.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]