SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013369369.1.14980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013369369.1.14980
Domain Number 1 Region: 38-484
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.85e-94
Family Levansucrase 0.0000000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013369369.1.14980
Sequence length 499
Comment levansucrase [Paenibacillus polymyxa]; AA=GCF_000164985.3; RF=representative genome; TAX=886882; STAX=1406; NAME=Paenibacillus polymyxa SC2; strain=SC2; AL=Complete Genome; RT=Minor
Sequence
MKFNKWFSKAATATVATTLLLGGGVQAFAKGNDEADSKADSAFTQITRSDMLNIFKQQGK
EKYEVPSFDASTIKNIPSAIGHDSSGKQIDLDVWDSWPLQNADGTVANYKGYNIVFGLAG
DPKRGEDTFIYLFYQKAGDTSLSGWKNAGRVFKDNDKLLSNDPILKNQSEEWSGSATLTS
DGQVRLFYTSRQPYDPNNKLYGKQTLSTAQINVSQPDDKTLKVDGVEDLKSIYDGGDGKT
YQNVQQSVGIDMDNHTLRDPHYVEDQGHKYIIFEANTGTETGYQGEDSIQNPAYYGGNKN
FFEEEQQNLLQSPKKKGAELANGALGIVELNDDYTLKNVMPPLIASNLVTDEIERANVFK
MNGLWYLFTSTRGSKVTVDAIGDDDIYMLGYVSTSLTGPYKPLNGTGLVLHQDLDRDDIT
WTYAHFAIPQGKGNNVVVSSYMTNRGLFPDHKSTFAPSFLLNIKGSKTSVVKNGILEQGQ
ITIDPANDKKENQNEYGKK
Download sequence
Identical sequences E3EI65
gi|310640216|ref|YP_003944974.1| WP_013369369.1.14980 WP_013369369.1.91857 gi|386039388|ref|YP_005958342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]