SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013369369.1.91857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013369369.1.91857
Domain Number 1 Region: 38-484
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.85e-94
Family Levansucrase 0.0000000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013369369.1.91857
Sequence length 499
Comment glycoside hydrolase 68 family protein [Paenibacillus polymyxa]; AA=GCF_000237325.1; RF=na; TAX=1052684; STAX=1406; NAME=Paenibacillus polymyxa M1; strain=M1; AL=Complete Genome; RT=Major
Sequence
MKFNKWFSKAATATVATTLLLGGGVQAFAKGNDEADSKADSAFTQITRSDMLNIFKQQGK
EKYEVPSFDASTIKNIPSAIGHDSSGKQIDLDVWDSWPLQNADGTVANYKGYNIVFGLAG
DPKRGEDTFIYLFYQKAGDTSLSGWKNAGRVFKDNDKLLSNDPILKNQSEEWSGSATLTS
DGQVRLFYTSRQPYDPNNKLYGKQTLSTAQINVSQPDDKTLKVDGVEDLKSIYDGGDGKT
YQNVQQSVGIDMDNHTLRDPHYVEDQGHKYIIFEANTGTETGYQGEDSIQNPAYYGGNKN
FFEEEQQNLLQSPKKKGAELANGALGIVELNDDYTLKNVMPPLIASNLVTDEIERANVFK
MNGLWYLFTSTRGSKVTVDAIGDDDIYMLGYVSTSLTGPYKPLNGTGLVLHQDLDRDDIT
WTYAHFAIPQGKGNNVVVSSYMTNRGLFPDHKSTFAPSFLLNIKGSKTSVVKNGILEQGQ
ITIDPANDKKENQNEYGKK
Download sequence
Identical sequences E3EI65
WP_013369369.1.14980 WP_013369369.1.91857 gi|310640216|ref|YP_003944974.1| gi|386039388|ref|YP_005958342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]