SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013370355.1.14980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013370355.1.14980
Domain Number 1 Region: 425-597
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.2e-51
Family Histidine kinase 0.00052
Further Details:      
 
Domain Number 2 Region: 354-435
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.1e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0003
Further Details:      
 
Domain Number 3 Region: 194-244
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000262
Family HAMP domain 0.0039
Further Details:      
 
Domain Number 4 Region: 244-360
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000105
Family PYP-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013370355.1.14980
Sequence length 600
Comment PAS domain-containing sensor histidine kinase [Paenibacillus polymyxa]; AA=GCF_000164985.3; RF=representative genome; TAX=886882; STAX=1406; NAME=Paenibacillus polymyxa SC2; strain=SC2; AL=Complete Genome; RT=Minor
Sequence
MKSFRFRLTLIMLILIGVSVLAAGITMGQIFKNSNMKVLEENMGREIDLLRATFPFVNAD
ALSSTDYVSYYSQKAKEIAHLTDSRVTFIRKDGTVVGDSLSDPRKMENHASREEIRQATS
EGIGRTIRYSETLQRNMLYVAEPVVSDKGFDGYIRLSMSLKAVEEGMQRGWTAIGIGLVL
LFIAAGLMSYRIARSLTSPIEHITGVANRISGLDYDARVGVQRRDEVGQLGEAINRMADS
LQNQMKTIRDNEDLLQSVMSNMTGGILMIDARECIALVNRESERMLGVVGKRVTDKPYHE
LKKHYELTKLIEGSIQSRERLHGEVHLYNPEERLVLLDGVPMYEDEGGYRGMLFLLQDIT
AIRRLENMRSEFVANVSHELKTPIAAVKGFAETLLGGGVKDEETARSFLQIIYDESERLN
RLIGDILELSKIESKRSPLDCSPIHISSFIESLLEKLNNVAAKKRITLHMDIPDELFMEA
DEDKLQQIFLNLLSNGINYTLDGGKVKIKVITLQRDNDTEKVVFTVSDTGIGIPKKDLPR
IFERFYRVDKGRSRNSGGTGLGLSIVKHLVDLHHGTLSVESELGLGTTFTVELPLLQQEE
Download sequence
Identical sequences E3EEP8
gi|386040269|ref|YP_005959223.1| WP_013370355.1.13814 WP_013370355.1.14980 WP_013370355.1.41886 WP_013370355.1.57060 WP_013370355.1.6267 WP_013370355.1.91857 gi|310641218|ref|YP_003945976.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]