SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013371285.1.91857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013371285.1.91857
Domain Number 1 Region: 652-986
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.3e-77
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000998
Further Details:      
 
Domain Number 2 Region: 395-626
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.7e-34
Family Laminin G-like module 0.048
Further Details:      
 
Domain Number 3 Region: 986-1144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.51e-30
Family Glycosyl hydrolases family 32 C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013371285.1.91857
Sequence length 1333
Comment cycloinulo-oligosaccharide fructanotransferase [Paenibacillus polymyxa]; AA=GCF_000237325.1; RF=na; TAX=1052684; STAX=1406; NAME=Paenibacillus polymyxa M1; strain=M1; AL=Complete Genome; RT=Major
Sequence
MRKVKIGKCWILGMVIWAMVLQLVVPGISVASENRTVAGETHIPKNDVKSSVTDTIYQIK
NIPKNDMGLSVPDSVYQIRNPGFETGDLTGWTVVKGDAFGPNSVTDETTWWAEKIPYNQE
GAYHLNGWKYDESATGILHSSTFVLGGSGWISFRLGGAKNPDKVFINIVEVDTGQVIARY
GNSAFADVGFPDPALGMRLANMVQYKADLSTYLGKKLYVEVVDNATSDWGVIFADAFSMY
HESEPAEGFVATDIKPDFKRYEIDNPSFETGNLDGWTVEGDAFEVTDEAHASKEGNFYAK
SSLQGKGSITSNTFTLQGTGTINFTVLDILKPENAYVALYDANSNTLLMKTGNVSANEKI
SWKVQEHYNKKLYVKVVDHSNEASIAVDSFQASGKGTIFYLNLDEGTGKKALEKVHNLKH
DVNYVFNNARYMASKDPRWTPRGIKGGALLFDGYSNYIEVNANDTVPVSDALTIEAWVAP
RSYEWGDGNKLSAIVNQSDQDKAEGFSLGMYRHGTWSMQVGIGGQWIQVWVKDHPLEKYK
WNYVAATFSKEDGKIKLYLNGEEVASQVTPLNVPITPSTESLIIGKNNKPVELAGVFSFN
MFSGLLDEVKLHNKALTNQEILAGYEGVKALHGGSIPKIPNADIDEDPSVFDGDQHRPQY
HAMPPQNWMNEAHAPIYYNGKYHLFYQHNPQGPFWHQIHWGHWVSDDMVNWENVRPALVP
EAGTLDPDGTWSGSAAYDRNGNPVLFYTAGNDSLSPNQRTGLATPADLSDPYLEKWVKYP
KPVTEQNGKGIHNEFRDPFVWYDKEVDKWYQLVTSGLPDFSSGTALVYVSDDMYNWEYKG
PLYVSDRSRYPELGTVWELPVLLPLGTDSTGKQKYIFMINPHEKPEHVPPANDVQRDVEV
FYWIGTWDRDNFKFIPDQEAPSKMDVGDGYLTAESGLVTPDGRTVVFSMVQNVRTPQAEY
QSGWAHNLSLPVSLSLDKHDKLHIEPIKELQSLRGKKWVDFSDKNLESANQLIKNVKGDM
LEIVMEIDPREAQKFGLKVRRSEKGQEETLIYYDKKNGTFNVDRTKSSIDPDVRVDGIQG
GYVDLKGENLKLHIFLDRSVIEAFANYKKKLTTRVYIGRYDSLGLQVWADGDINIKSMQV
WDMNALTGKPAAPVYVPDKWDNSVYKDITELPNHDFATGDLTGWITEGDAFQNVHVTNTQ
FFWDNIYFNPSHKIPGGYHLWGFNEQAGGDSLTGSLRSQNFVLGGNGKINFLISGGRDID
RLYVALVRASDGKELFKETATNYEEYQRKIWDASDYIGEELYIKVVDQSKGGFGHINVDD
FNVPVQVKKKTNN
Download sequence
Identical sequences E3E4E1
gi|310642164|ref|YP_003946922.1| WP_013371285.1.14980 WP_013371285.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]