SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013371341.1.91857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013371341.1.91857
Domain Number 1 Region: 317-459
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.58e-27
Family Histidine kinase 0.0023
Further Details:      
 
Domain Number 2 Region: 225-303
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000104
Family Homodimeric domain of signal transducing histidine kinase 0.0032
Further Details:      
 
Weak hits

Sequence:  WP_013371341.1.91857
Domain Number - Region: 180-229
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00183
Family HAMP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013371341.1.91857
Sequence length 466
Comment two-component sensor histidine kinase [Paenibacillus polymyxa]; AA=GCF_000237325.1; RF=na; TAX=1052684; STAX=1406; NAME=Paenibacillus polymyxa M1; strain=M1; AL=Complete Genome; RT=Major
Sequence
MEVAKIQQAHKTTKLRTIFLGYLVMFCIGTIALALFLVLTFYILMSCGTILPANYAENQV
REDKAILEAGKTLQPDSRQKLYRYASFTSEGRHIEGNLSEKQAQAAWSVTQQSNTAYQFP
YNYVKVSHNNEVTVMRYSVSAQFELPILRQYLPNAELSFFAVFCIAFLGGGALLASSFGR
KLTRKMSGLQQATKQIQAQDLDFSIQLSGVMEIDRVLHSMDKMKETLKTSLQKQWNLEKS
RREQISALAHDVKTPLTIVRGNVELLSETDQSEEQKNYTDYIAESTRQMEQYIKTLIEIS
KAETVATLQAETIDTDFYLTKIKDQVMALAAVRKISVVFATYNLPSTLYVDPVLLERAIM
NVASNAVEQAPEYSEIRLTAESAEECIRLSIVDEGPGFSPEGLKQATEQFYMGDSSRRLT
GHYGMGLYITKSIVNLHGGQLIITNSTQTGGGQVSIEIPIRVSSTS
Download sequence
Identical sequences E3E652
WP_013371341.1.14980 WP_013371341.1.91857 gi|310642220|ref|YP_003946978.1| gi|386041178|ref|YP_005960132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]