SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013371442.1.14980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013371442.1.14980
Domain Number 1 Region: 297-462
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.11e-47
Family Histidine kinase 0.00089
Further Details:      
 
Domain Number 2 Region: 224-307
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.75e-21
Family Homodimeric domain of signal transducing histidine kinase 0.00057
Further Details:      
 
Domain Number 3 Region: 189-237
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000131
Family HAMP domain 0.0064
Further Details:      
 
Weak hits

Sequence:  WP_013371442.1.14980
Domain Number - Region: 9-58,145-182
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0445
Family Calcium ATPase, transmembrane domain M 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013371442.1.14980
Sequence length 476
Comment MULTISPECIES: two-component sensor histidine kinase [Paenibacillus]; AA=GCF_000164985.3; RF=representative genome; TAX=886882; STAX=1406; NAME=Paenibacillus polymyxa SC2; strain=SC2; AL=Complete Genome; RT=Minor
Sequence
MIKKGIRRQIVLHYFFVVFLALLLVEVIFMFALRSYYYDTIYKKIENRIQSVSEFASKFK
EPEQSLQSYLLDTFSLPNTELQLLDEQGNVIDNSTNFAADLSVQTSDVTQALAGDTGKWI
GKQPSTGQQVMAVSQKLDNIVGDQVYIIRYTTSLELVNDKLFIITLFSVGIMAAVLIIVF
VVSTGLANSIVRPINNIRDVSAQMAQGRFDARIKGDYRYELGELASTLNYMAQEIVRTNQ
IKDDFISSISHELRTPLTSIKGWSETLNSGGYDPEETKIGMQIISKETDRLIGLVEEILD
FSKLEQNAMKLVMGTVDLRELLQEIMLNVWAKAEMKQIKLQLDSEETAYLVHGDGNRLKQ
VFLNIVDNAIKFSHESSIIYLSLQRVKGNIEISVQDTGIGISEENLARVRDRFFQVDHQN
GGTGLGLAISQQFVERHHGQMLIRSELGAGTTITVSLPALQAEPSVEPPQLSEGQI
Download sequence
Identical sequences E3E7N4
WP_013371442.1.14980 WP_013371442.1.57060 WP_013371442.1.6267 WP_013371442.1.91857 WP_013371442.1.99789 gi|310642322|ref|YP_003947080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]