SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013371583.1.91857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013371583.1.91857
Domain Number 1 Region: 75-282
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.4e-31
Family Acetylhydrolase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013371583.1.91857
Sequence length 315
Comment MULTISPECIES: lysophospholipase [Paenibacillus]; AA=GCF_000237325.1; RF=na; TAX=1052684; STAX=1406; NAME=Paenibacillus polymyxa M1; strain=M1; AL=Complete Genome; RT=Major
Sequence
MFISPSYQEGTRVNSSKWIWRSVGSVSIAATLLLLYGFIAAVRSITAPEPLVSTQPVQSG
SSQTQTAPSATAQTEELRVAAIGDSLAKGTGDDSGSGFVRRSVTLLNDQEGHKARLINNL
GINGLTTQGLLTKLDEPGVSYVLKKANVIIVSIGGNDLFQGAQAAQTGKEPPTLSGLRKA
LPDAAKRLQKVLTKVGKINPNAKIVYVGLYNPFSDLREMKIPGNLVVTEWNMAAMAITNQ
NSNMTLVPTFDLFEQNLPVYLSSDHFHPNGQGYQAIAERIAQGFAVTATKGTDHVNPNQQ
STSSQPAEAKKGGNK
Download sequence
Identical sequences E3E7V0
gi|386041536|ref|YP_005960490.1| WP_013371583.1.14980 WP_013371583.1.31500 WP_013371583.1.41886 WP_013371583.1.57060 WP_013371583.1.91857 WP_013371583.1.99789 gi|310642466|ref|YP_003947224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]