SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013371734.1.13814 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013371734.1.13814
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 1.44e-32
Family Sigma2 domain of RNA polymerase sigma factors 0.00074
Further Details:      
 
Domain Number 2 Region: 170-249
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 2.06e-17
Family Sigma4 domain 0.012
Further Details:      
 
Domain Number 3 Region: 108-184
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 1.48e-16
Family Sigma4 domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013371734.1.13814
Sequence length 251
Comment MULTISPECIES: RNA polymerase sporulation sigma factor SigF [Paenibacillus]; AA=GCF_000520795.1; RF=na; TAX=1333863; STAX=1406; NAME=Paenibacillus polymyxa 1-43; strain=1-43; AL=Contig; RT=Major
Sequence
MEAGGKKTSHSYLEDTEVKRLIALSQSGDNDARETLVNSNIRLVWSVVQRFMNRGYEPDD
LFQIGCIGLLKSVDKFDLSYEVKFSTYAVPMIIGEIQRFLRDDGTLKVSRSLKETANKVR
KMKDELSKRLNRLPTVKEVADELGVTPEDVVFAQEANKPPTSIHETVFENDGDPITLMDQ
IADESQERWFDKLALNEAIDGLSERERLIVYLRYYRDQTQSEVASRLGISQVQVSRLEKK
ILQLIRDQIAQ
Download sequence
Identical sequences A0A0F0G9L0 E3E826
WP_013371734.1.13814 WP_013371734.1.14980 WP_013371734.1.16985 WP_013371734.1.29540 WP_013371734.1.31500 WP_013371734.1.36933 WP_013371734.1.57060 WP_013371734.1.6267 WP_013371734.1.71998 WP_013371734.1.78809 WP_013371734.1.88866 WP_013371734.1.91857 WP_013371734.1.99789 gi|386041682|ref|YP_005960636.1| gi|310642622|ref|YP_003947380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]