SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013372508.1.13814 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013372508.1.13814
Domain Number 1 Region: 299-453
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-28
Family Histidine kinase 0.0068
Further Details:      
 
Domain Number 2 Region: 230-308
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000275
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Weak hits

Sequence:  WP_013372508.1.13814
Domain Number - Region: 193-242
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00497
Family HAMP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013372508.1.13814
Sequence length 459
Comment MULTISPECIES: two-component sensor histidine kinase [Paenibacillus]; AA=GCF_000520795.1; RF=na; TAX=1333863; STAX=1406; NAME=Paenibacillus polymyxa 1-43; strain=1-43; AL=Contig; RT=Major
Sequence
MRTMRAKILLSLSIAMLITVCITVVLFIRLIDDILVNQAKSKLHEQARKAVHIMSDGGFD
RLDNAELNYVIKGVLLSADYFILSTDNRIIDSSVSGMEGKKLERLLLTRQGFFASVHPSA
HDLVTTHEGVAVLQGKKILFTNEELPGQPFRIFVYSPLSSLRALYVPLMRTTLLSIVASF
LVILVIGLMVVSRLVRPLKRLKEAVGNYEPNQPQDSDFPQADKSEIGELIGTFHSMSARI
QQHHHSQIEFLQNVSHELRTPLMSIQGYVYAIQDQVVSQDEGLSIIKVQSQRLIDMVEKL
LQLSRLEALNEEWPVSLIDLRSMAEDAVHLLMPMASERSISLRVEGEGLHVAVPAEQLFR
MILNLLQNAVRHTSTEVVIHLETGTTPEVVWVMHVDDDGEGLTESEAAEVFGRFYTGSNG
ATGLGLAICRQIASRLNGELLCTRSPLGGARFSYIQRMS
Download sequence
Identical sequences E3E5Q2
WP_013372508.1.13814 WP_013372508.1.14980 WP_013372508.1.31500 WP_013372508.1.91857 WP_013372508.1.99789 gi|507716688|ref|YP_008049297.1| gi|310643412|ref|YP_003948170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]