SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013376540.1.14028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013376540.1.14028
Domain Number - Region: 302-371
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00105
Family Collagen-binding domain 0.018
Further Details:      
 
Domain Number - Region: 184-268
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00366
Family Collagen-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013376540.1.14028
Sequence length 424
Comment protease [Stigmatella aurantiaca]; AA=GCF_000168055.1; RF=na; TAX=378806; STAX=41; NAME=Stigmatella aurantiaca DW4/3-1; strain=DW4/3-1; AL=Contig; RT=Major
Sequence
MWSTLRTVVALAGCVFVPVEAQAQFGQCGMDAISQADAANRVEWARRCALNKLATVQGFA
VTDGANPMIDYQEVDPLTNPSGQNAFHGDISNFEINGTYAYALFAGMPSSQVLDAYGFYQ
WTSTHRRPNPYYPLFGTTPTPGAGSQLYPHPQLKDCNLYTDRSGYNAAPTFYVNMYCNST
SAALSNGVPVSGLTHSAGGEKHFTVAIPEGSVGLSIALSGGTGNADLYIKRGAVPTEASY
DCASRSSGNYDSCYVAAAEGTYYVLVKGVVGYSNLSVTARWNALARYSPVSNLYAGLGTE
KLYTFYVPGNVSSATFSLSGGTGDADLYVRYGAAPTLTEYNCRPYTGGSTETCTFSYPSA
GTYYVMVRAWSRFSGVTLSANYVEMPPEPPSCLQQAVCPANMACPIPVPCLAEEEAPASQ
PVRY
Download sequence
Identical sequences E3FFH3
WP_013376540.1.13107 WP_013376540.1.14028 gi|310822199|ref|YP_003954557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]