SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013382158.1.80573 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013382158.1.80573
Domain Number 1 Region: 1134-1193
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000209
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013382158.1.80573
Sequence length 1197
Comment MULTISPECIES: surface/cell-adhesion protein [Clostridiales]; AA=GCF_001753695.1; RF=na; TAX=1487; STAX=1487; NAME=[Butyribacterium] methylotrophicum; strain=DSM 3468; AL=Contig; RT=Major
Sequence
MEGLRKTKPAKWLCFFLALLLTLTCFTPFARAEENTSQEAGNTVLADTAQHEAEAVSEEK
GTPSLKQDAEGNYLIGSVEDLNTLRADIVRDIEYENEHLLLTADIDAGNLTPYPELPPTD
EPYTTSEGLFGYIFRGKLNGMGHKIYNFKDSGSGLFDVLAPGAQIGNLTIEANVNFTKDT
KKLRSSVYGVIANMMPGAWIQRCATTGSVTIQSDYQGYVGFSGMVDFYNPPKEANVSNSS
EYKGTIEDSYSTIVFTNNTQSSANFYGIGPGVQVLKNCFFAGSFKGKVNKEISQPLARMS
TANENMESCYFDSLKISTLLTNAQGEKVPTYKMRSQGTFKGWDFGKIWKMGDDHPVLNTG
YTILKDKVILDTEVVLEPRVYSEALGGDSTLTRVQDIKIKTDLGGNPHQVTIDYEETPDT
KNTFYVGMMGDHARGLAQFDKVEVKYTENDEAEYYLPSDFYKYADRKQAEAWGSFTQDGT
VLSDDQKQELIDQAKKACDLIFDYKLGSTPDAATVASDSWLVFSAARCNYKVPDGFWDQV
YKQYEARYAAYKAQGQVDGFDTSDTAKDVLAISAIGYDPRNVGGYDLLDVIINHSGDRDY
FASQTAAFAMYSNDFDESQYGYSMADYVKSKVTPIEVDADGVKVEKDQAADMWTMAWQPL
MFFYDPNAQEGSEWYDLKLFVEDGLNQISAAQTYMGNCWGGYINSADSTGKPKYDITNTW
TNAQVQISVGLAGIDPFDARFVKNGNTLITRAVSFFEGGQVGGDVKGGESAQVARGLNSI
IRAYEQNPHNLFDCRDVEDSTVQINNAIGALPEAAAITEEKRQDFDQCWEQYNKLNDTQK
SNISNTNKEKLQAIYEKFYPDENLESALELAKTELSKSNVSEIYTQDSINNLKAAVEAAE
KVQKDTQATSEQKAEQASKLRKAVEALVTTEAEDMKKVETAIDQIKPFTTLEGRKPVDTA
KDLYDKLKYDESRERIKNRDTLLSNVTAVEGLEAAGDSLKAAIAAAKEQLAQTDKYLASS
IEAARQYITIAEKVDVQTSTVQELANAQITLERYVNDTLKEQPDKTELNNKIAEITEKMK
ALDEKDYSAEKWKTLEDALSTAKDVAESNDADGGAVTSAIEGLDNAFNGLEEDVMLGDVT
GDGKINGLDVTWVMQYNVGSRALDEKAMKAADVNNDGKVNALDVTWIMQHNVGLRTF
Download sequence
Identical sequences A0A1E7RVS5 E3GGP6
WP_013382158.1.44369 WP_013382158.1.80573 gi|310829457|ref|YP_003961814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]