SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013390599.1.72589 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013390599.1.72589
Domain Number 1 Region: 223-362
Classification Level Classification E-value
Superfamily CBS-domain pair 4.04e-27
Family CBS-domain pair 0.0026
Further Details:      
 
Domain Number 2 Region: 373-450
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000354
Family CorC/HlyC domain-like 0.0034
Further Details:      
 
Weak hits

Sequence:  WP_013390599.1.72589
Domain Number - Region: 187-213
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0294
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013390599.1.72589
Sequence length 452
Comment MULTISPECIES: HlyC/CorC family transporter [Bacillus subtilis group]; AA=GCF_000264395.1; RF=na; TAX=334727; STAX=1452; NAME=Bacillus atrophaeus C89; strain=C89; AL=Contig; RT=Major
Sequence
MLEDDRKREVYAFLSEGRPLEYTKLIAVAVLIMVTAFFVAIEFSIVKVRRSRIDQYVAKE
IKGAKAAKHVITHLDEYLSACQLGITVTALGLGWLGEPTVQTLLHPLFLKLGLHESLTHF
LSLVIAFLLVTYLNVVIGELAPKSFAIQKAESITLMFAKPMIWFYKIMFPFIWVLNQSAR
LITGMFGLKPASETELAYTEEELRVLLAESYKSGEIKKSELKYMNNIFTFDKRMAKEIMV
PRNEMVSLPIDDESVESLQEIIKQTKYTRYPVVKEDKDHVIGVMNIKEVLFSLLSERFSF
TKEQLDPFIQPVIHVIETIPIYQLLIKMQKERTHMAILIDEYGGTSGLVTVEDIVEEIVG
EIRDEFDADEIPHIRELDKNHYMLNAKVLVSQVNDLLGTDLSDEEVDTIGGWFLTQDIDA
APESVIEYDGYAFKVKDIDSHHILFIEVKKAE
Download sequence
Identical sequences A0A0H3E5N5
gi|311069077|ref|YP_003974000.1| WP_013390599.1.100936 WP_013390599.1.10353 WP_013390599.1.15971 WP_013390599.1.16994 WP_013390599.1.30485 WP_013390599.1.32777 WP_013390599.1.39473 WP_013390599.1.39900 WP_013390599.1.40255 WP_013390599.1.59507 WP_013390599.1.62747 WP_013390599.1.68581 WP_013390599.1.69262 WP_013390599.1.70004 WP_013390599.1.72589 WP_013390599.1.72801 WP_013390599.1.7305 WP_013390599.1.7508 WP_013390599.1.79721 WP_013390599.1.94463 WP_013390599.1.99425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]