SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013442119.1.53399 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013442119.1.53399
Domain Number 1 Region: 131-253
Classification Level Classification E-value
Superfamily NTF2-like 1.79e-21
Family SnoaL-like polyketide cyclase 0.081
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily NTF2-like 1.03e-16
Family SnoaL-like polyketide cyclase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013442119.1.53399
Sequence length 257
Comment hypothetical protein [Methylovorus sp. MP688]; AA=GCF_000183115.1; RF=na; TAX=887061; STAX=887061; NAME=Methylovorus sp. MP688; strain=MP688; AL=Complete Genome; RT=Major
Sequence
MTPTAKQQVIQLLKSIETGEQAPVGYINAEKYIQHNLNVGDGLAGFGSVLQQLPKGSAKV
NTVRVLQDGDFVITHTEYDFFGPKIGFDIFRFEHGKIVEHWDNLQQTPAQANPSGHTMTD
GDKTIKDLEKTAANKKLVADFVDDVLVNGKLEKLASYFDGDHYIQHNPAIADGLSGLGAA
LKYLAEQGITMKYNRVHQVLGEGNFVLVISEGEFAGKWTSFYDLFRVQNGKIAEHWDTME
AIPPRQDWKNQNGKFGF
Download sequence
Identical sequences WP_013442119.1.53399 gi|313201074|ref|YP_004039732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]