SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013442974.1.53399 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013442974.1.53399
Domain Number 1 Region: 143-272
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.00000000000000876
Family L,D-transpeptidase catalytic domain-like 0.0095
Further Details:      
 
Domain Number 2 Region: 294-400
Classification Level Classification E-value
Superfamily NTF2-like 0.0000000368
Family CHU142-like 0.092
Further Details:      
 
Domain Number 3 Region: 40-92
Classification Level Classification E-value
Superfamily TPR-like 0.00000514
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013442974.1.53399
Sequence length 404
Comment hypothetical protein [Methylovorus sp. MP688]; AA=GCF_000183115.1; RF=na; TAX=887061; STAX=887061; NAME=Methylovorus sp. MP688; strain=MP688; AL=Complete Genome; RT=Major
Sequence
MNTIKTFLQILLMASIMVPWNVPALDRLDYTGTLSNSSFGPNYPESLVVKGLLQITRGQL
QQALNTVDELISIAPNFKLAYLIRGDLLMAKSQQLEGFGNTPQNNSPSVEDFKAEARMRI
ERYLESHAPQGVPEPLWQIDPTQKYVIVVDADKSRLYLYQNIGGKPTYVADYYVTIGRNG
SEKSSEGDKRTPLGVYTASSKLTSKLPDFYGRAAYPLSYPNEWDRQQGKKGHGIWLHGTP
SNTYSRPPRASDGCVVISNPDLETLGPILQQGGTPFIIVSQLKWVTQAAPEQPQLQKALD
QWRQDWQAQDTDRYLSHYSDRFFSQTSDINGWSREKRRIQSDKKPVSIVLSNISMIRYPN
SQIPMAVVSFDQEFKSEFLDSRMRKRQYWIYEGQRWKILYEGAA
Download sequence
Identical sequences gi|313201930|ref|YP_004040588.1| WP_013442974.1.53399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]