SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013450307.1.25879 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013450307.1.25879
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000238
Family Thioltransferase 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013450307.1.25879
Sequence length 81
Comment redox-active disulfide protein 2 [Calditerrivibrio nitroreducens]; AA=GCF_000183405.1; RF=representative genome; TAX=768670; STAX=477976; NAME=Calditerrivibrio nitroreducens DSM 19672; strain=DSM 19672; AL=Complete Genome; RT=Major
Sequence
MNIKILGTGCRNCEILYKTVCEAVEQLQLTDVTIEYVKEINEIIKYVMTTPGLVIDEVLV
HEGKPLPNVEQVKNIILQMKK
Download sequence
Identical sequences E4TJ54
gi|313672142|ref|YP_004050253.1| WP_013450307.1.25879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]