SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013451667.1.25879 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013451667.1.25879
Domain Number 1 Region: 11-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.8e-47
Family NQO2-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013451667.1.25879
Sequence length 164
Comment hydrogenase HoxE [Calditerrivibrio nitroreducens]; AA=GCF_000183405.1; RF=representative genome; TAX=768670; STAX=477976; NAME=Calditerrivibrio nitroreducens DSM 19672; strain=DSM 19672; AL=Complete Genome; RT=Major
Sequence
MFGRPTLPSEDKRWKIIQNTMKKNGYNPDSLIEVLHAVQEYFGYIDEDALKFVSESLNIP
YSRAYSVATFYHYFTLKPQGEHICVVCTGTACYIKGANQLLAHLKNHHDLSDGDTTKDGK
VSLLTARCVGACSLAPVVVVDNKILGEINSEKLDDVIKGCRDAV
Download sequence
Identical sequences E4TF16
WP_013451667.1.25879 gi|313673508|ref|YP_004051619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]