SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013458754.1.73382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013458754.1.73382
Domain Number 1 Region: 114-538
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.49e-105
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000251
Further Details:      
 
Domain Number 2 Region: 1-127
Classification Level Classification E-value
Superfamily Cytochrome c 8.92e-25
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013458754.1.73382
Sequence length 539
Comment nitrite reductase [Oceanithermus profundus]; AA=GCF_000183745.1; RF=representative genome; TAX=670487; STAX=187137; NAME=Oceanithermus profundus DSM 14977; strain=DSM 14977; AL=Complete Genome; RT=Major
Sequence
MRWSKALTVGLAALALGALAVAQGLTPEQMEEGKKIYFQQCAGCHGVLRKGATGKNLEPD
KLKAAGKNVDYLKAIITNGFGGMPAWGKLGILTPEQIDLMAKFLLSPVPEPPPWTFEDIK
NNWVVYVPVSKRPTQPETTRNWQNFFGVILRDMGQVAIVDGDTKELVKILPTGYATHILR
SSKDGRYFYVIGRDGKAEIIDLWSKEPTLVAEAKVCLDARSIDTSKYEGYEGKYAVVGCY
WPSNFVILDGQTLEPLKMVSTQGYVKSTGEFLRENRVASIVSSHFSPEWILNIKEGGQTW
LVDYANIGLKGKPINVRMIDTERFLHDGGWAMDKRYFLVAANAAKKIVVIDAKTGEFVAS
IPVGDKPHPGRGANWVHPKYGPVWATGHIKDNKIAVIGTDPKGHPDYAWKVVKMIETPYP
GNLFIKTHPKSPWLIVDFTVAPTPEANATLCAWKKEDLEKDPICWEVPGAKKLKARMVHI
EFNKDGSEFWVSAWGNKDTPTFIVVYDSVTLQEKTRITGDWVRTPTGKFNVWNTANDIY
Download sequence
Identical sequences E4U5B0
WP_013458754.1.73382 gi|313681018|ref|YP_004058757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]