SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013483532.1.63498 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013483532.1.63498
Domain Number 1 Region: 34-94
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000706
Family Type I dockerin domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013483532.1.63498
Sequence length 425
Comment dockerin [Ruminococcus albus]; AA=GCF_000621285.1; RF=na; TAX=697329; STAX=1264; NAME=Ruminococcus albus 7 = DSM 20455; strain=DSM 20455; AL=Scaffold; RT=Major
Sequence
MRKVFKCINKVIASAIAALLAVSGTVLVSFADDYQKGDVNRSGSINVTDIISVAAHIKGK
RLIDPEYQYLADINEDGIINISDITTIAARVKGYYANKVPEKVNFTSTDTSPSYLFLKQN
YKGMVKSKELDPNSNNGVLFDNLYYGYQIDDNTYRLYSRNTYTDVPKKYVRDGVFITNKY
NNILNVGNISQFDNELNVTEYNGKDKDLSCGPACIAMAVTSEFKKNVSITDVFVDGNNYA
WSIGAIPKNLYAHNYNYTPWNFEWCEAGGNGTTLNGMFRLMQIYADREGKTAVSPVVNYY
ESNNKTIDKIDKALSEGHTVVASVLFNSRYVAFNGYSNTIRAAANFLPANPFIHYVVIAG
ECDGSGKYDGYYAVADPYKKALKDINGNLVCDDINSGLTIVRKQTMAGSINQMYDSWYRG
IVYVK
Download sequence
Identical sequences E6UJY7
gi|317133958|ref|YP_004089869.1|NC_014824 gi|317133958|ref|YP_004089869.1| WP_013483532.1.49193 WP_013483532.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]