SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013483547.1.49193 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013483547.1.49193
Domain Number 1 Region: 30-100
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000101
Family Type I dockerin domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013483547.1.49193
Sequence length 370
Comment hypothetical protein [Ruminococcus albus]; AA=GCF_000179635.2; RF=representative genome; TAX=697329; STAX=1264; NAME=Ruminococcus albus 7 = DSM 20455; strain=7; AL=Complete Genome; RT=Major
Sequence
MNKFGKIVSSLTALMILGSTFTVNAGAETFYTKGDINNSGTVNITDIIKIASHIKSKKML
SEERNDILVPYTTLWAADVNRDGKLNITDITTIAAQIKNVKSISSSTNAFKNVRKLTTPT
ETDIIARALRLTEANLKYYSPNEPRKYDFTKGNDKAEKIILKEGIDCSGIINYALGTLGI
ETEGLRGSSNTNAAQFGYTPAATGDWLNKYNVIKPVKNAYWIVDGTKKPMKVLKNGVSTS
KQKYYQYGKNNDIIPVGSIVVAFAEDNKGNRMANADHMWLYLGEYNNANEVRKYIASLTD
KAPGDIMTRIGSQKIGYNSNNSDNDGKHWRLESTGTWHGFDNFTGPQINNDLCNNTKTQY
LIYVFAPPTF
Download sequence
Identical sequences E6UK02
gi|317133973|ref|YP_004089884.1|NC_014824 gi|317133973|ref|YP_004089884.1| WP_013483547.1.49193 WP_013483547.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]