SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013483746.1.63498 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013483746.1.63498
Domain Number 1 Region: 65-115
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000051
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013483746.1.63498
Sequence length 121
Comment hypothetical protein [Ruminococcus albus]; AA=GCF_000621285.1; RF=na; TAX=697329; STAX=1264; NAME=Ruminococcus albus 7 = DSM 20455; strain=DSM 20455; AL=Scaffold; RT=Major
Sequence
MNGFVKKIAGIMSAVVCMGSAVVSAYAAPVLTDEDARVCSTVVEVKPELVEETERAVFVA
EVSEKGDINGDNVINVVDVAALAAHIKGDKIIDTDAADINSDGFVNITDLSLLSVKVKGN
G
Download sequence
Identical sequences E6UKK5
WP_013483746.1.49193 WP_013483746.1.63498 gi|319788772|ref|YP_004090087.1|NC_014825 gi|319788772|ref|YP_004090087.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]