SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013485939.1.100024 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013485939.1.100024
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.24e-38
Family N-utilization substance G protein NusG, N-terminal domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 116-171
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.89e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013485939.1.100024
Sequence length 173
Comment transcription termination/antitermination protein NusG [Ethanoligenens harbinense]; AA=GCF_000178115.2; RF=representative genome; TAX=663278; STAX=253239; NAME=Ethanoligenens harbinense YUAN-3; strain=YUAN-3; AL=Complete Genome; RT=Major
Sequence
MSENAKWYVVHTYSGYENKVASNLQTIVENRSLQDVIQEIKIPTEMVTEIKDNVKREVER
KTFPGYVLVKMELNDDTWHIVRNTRGVTGFVGSGSHPEPLTEKEVEALGMDKRTVEVNYA
VGDSVRIVDGPLDGFIGTVDTLDTDKNQVTVTVSMFGRETPVELELGQVEVIQ
Download sequence
Identical sequences E6U3J1
WP_013485939.1.100024 gi|317133008|ref|YP_004092322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]