SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013498465.1.49193 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013498465.1.49193
Domain Number - Region: 40-104
Classification Level Classification E-value
Superfamily PA domain 0.0144
Family PA domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013498465.1.49193
Sequence length 149
Comment hypothetical protein [Ruminococcus albus]; AA=GCF_000179635.2; RF=representative genome; TAX=697329; STAX=1264; NAME=Ruminococcus albus 7 = DSM 20455; strain=7; AL=Complete Genome; RT=Major
Sequence
MRIFIDADGCPVVRLTLDIAKKHEIPVTIVCDTAHEFSRYDAEVITVDKGADSADFALVN
LMEKGDIAVTQDYGLAAMCLAKKAYAINQNGLVYNSDNIDSLLMSRHIAKKLKRSGNHLK
GPAKRTSDNDKKFVAALENLITETFGKDG
Download sequence
Identical sequences E6UA79
gi|317056468|ref|YP_004104935.1| WP_013498465.1.49193 WP_013498465.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]