SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013499180.1.63498 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013499180.1.63498
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 3.92e-39
Family N-utilization substance G protein NusG, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 119-173
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000411
Family N-utilization substance G protein NusG, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013499180.1.63498
Sequence length 175
Comment transcription termination/antitermination protein NusG [Ruminococcus albus]; AA=GCF_000621285.1; RF=na; TAX=697329; STAX=1264; NAME=Ruminococcus albus 7 = DSM 20455; strain=DSM 20455; AL=Scaffold; RT=Major
Sequence
MAEEAKWYVVHTYSGYENKVAQNIEKVVENRKLHDLIPEVRIPMETVTEIKGEKTVEAEK
KLFPSYVLVKMVLTDDSWYIVRNTRGVTGFVGPGSKPVPLSDREVEALGVDVGTQTVRTD
IAVGDDVIMVGGSFDGMSGTVSSLDLENAAADVTVSMFGRETTVTLPLTQLRKED
Download sequence
Identical sequences E6UFR2
gi|317057218|ref|YP_004105685.1| WP_013499180.1.49193 WP_013499180.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]