SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013499775.1.49193 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013499775.1.49193
Domain Number 1 Region: 27-86
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000262
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013499775.1.49193
Sequence length 307
Comment dockerin [Ruminococcus albus]; AA=GCF_000179635.2; RF=representative genome; TAX=697329; STAX=1264; NAME=Ruminococcus albus 7 = DSM 20455; strain=7; AL=Complete Genome; RT=Major
Sequence
MNKLIMTAVSLICACSISAYADGASAAKGDVNGDGAVTITDVSKIAAHIKTKKMIQGESL
QNADVNYDGKVNISDLSLTAAYIKGKKTFPDDPRIADETFKGYDAFLMFADGSMNWGNWN
GQGYYSAPSFGDDADITNDGVYSVSITKKSITAKDDTGTNPSLLYGSDGSLLPAKGCTML
CVDITGLLDGTLAADGSELEGFLKSGNDANVNKHVKGKFRGDELNVTVTGIAIDGNYIEF
DPSKIRYGNLDEEDNCYRICIADLLSGSAEDAAIDTGNLSFKNSITVEFSISGIDKNEHT
SYDDIFG
Download sequence
Identical sequences E6UFZ5
gi|317057836|ref|YP_004106303.1| WP_013499775.1.49193 WP_013499775.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]