SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013561563.1.43297 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013561563.1.43297
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily Ribose/Galactose isomerase RpiB/AlsB 3.01e-39
Family Ribose/Galactose isomerase RpiB/AlsB 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013561563.1.43297
Sequence length 150
Comment MULTISPECIES: ribose 5-phosphate isomerase B [Desulfurococcus]; AA=GCF_000186365.1; RF=representative genome; TAX=765177; STAX=2275; NAME=Desulfurococcus mucosus DSM 2162; strain=DSM 2162; AL=Complete Genome; RT=Major
Sequence
MRVAVGSDDTYSVAGFIAEYLRRKGFEVKLVGALATGKPYPWPDVGFEVGSMVARGEVDY
GVVICYTGTGVSIAANKVKGVRAALVTDARNAEGARKWNDANVLALSARLTSEELAKEII
DAFFAVREVDPSEAENIRKLKAVDTLGDTR
Download sequence
Identical sequences E8RAD1
WP_013561563.1.43297 WP_013561563.1.60640 gi|320100231|ref|YP_004175823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]