SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013562826.1.60640 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013562826.1.60640
Domain Number 1 Region: 8-113
Classification Level Classification E-value
Superfamily Prefoldin 3.79e-19
Family Prefoldin 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013562826.1.60640
Sequence length 121
Comment prefoldin subunit beta [Desulfurococcus mucosus]; AA=GCF_001006085.1; RF=na; TAX=675631; STAX=2275; NAME=Desulfurococcus mucosus DSM 2161; strain=DSM 2161; AL=Scaffold; RT=Major
Sequence
MSEKPLPPEVQNMIIHYQSILENKAKMEAELRIIEAELSDIENILETLKNLGDDAELYKA
LGHVLVKKSKADVVKELEERKELLTVKRDKYRKQLDFLTKEAGNLEGRIKEALSKHGYTT
S
Download sequence
Identical sequences E8R7D9
gi|320101494|ref|YP_004177086.1| WP_013562826.1.43297 WP_013562826.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]