SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013622332.1.93229 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013622332.1.93229
Domain Number - Region: 20-64
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0282
Family Recombination endonuclease VII, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013622332.1.93229
Sequence length 200
Comment zinc-ribbon domain-containing protein [Cellulophaga lytica]; AA=GCF_900197635.1; RF=na; TAX=979; STAX=979; NAME=Cellulophaga lytica; AL=Contig; RT=Major
Sequence
MIFYGSNSSQLKSKLTRQIPCANCNESAKFNVEVYGKYAHLYWIPIFPIGKTGGAVCTNC
NTVFEPKQMDHNLKLEYQNVKDEAKTPIRHFSALFIIAILITGLSVSSFLDGKNSEEYIA
HPMVNDLYEFKTEANYYSTMKISSISDSIYFKFNEYETNKKSGISEIDIPKNYEEQEYGY
TTKELQGLFKDNIIYEVKRN
Download sequence
Identical sequences F0RB12
gi|325287670|ref|YP_004263460.1| WP_013622332.1.53776 WP_013622332.1.62073 WP_013622332.1.93229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]