SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013719720.1.75657 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013719720.1.75657
Domain Number 1 Region: 109-414
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 4.32e-52
Family TM0189-like 0.014
Further Details:      
 
Domain Number 2 Region: 35-91
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000405
Family Type I dockerin domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013719720.1.75657
Sequence length 420
Comment periplasmic-binding protein [Methanosaeta concilii]; AA=GCF_000204415.1; RF=representative genome; TAX=990316; STAX=2223; NAME=Methanosaeta concilii GP6; strain=GP6; AL=Complete Genome; RT=Major
Sequence
MKMKRSSEFVMLLIALCASSCAICSSSLAFSYTLNIFGNANMDDAINESDIAYLEDVIAG
RSPATELSDANLDGIVDGKDIEQVERLIDGTGEQLTLKAYTIYEELMNVTIPMPVERIVV
LNLACAESVRGIKAQDKIVGVGSSLVEGANRDFFPEMIDLPTVGKWSEPDIEAIISLNPD
IVIADLRTPDPEKLEDKLEGTGITVVRMGFTYPDYSSSEIMALGYILDRKDDARELNSFA
GKYSDLIEERLSSIAESERPRVYPIYYTSADLWKTGSNGSIVDMLCGLAGGENIAHDLTG
GTGGMYPTVDPEWVVGENPQIIFTWSSPGGYSLANDSAMRELWTKIVQAPELSRVDAAKD
ERVHLMTTEITSRPRWFVGLSYLAKWFYPEKFLDLDPEAIHKEYLERFQGLEYQGIFVYP
Download sequence
Identical sequences F4BXK3
gi|330508071|ref|YP_004384499.1| WP_013719720.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]