SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013720855.1.92526 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013720855.1.92526
Domain Number 1 Region: 2-542
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.57e-176
Family Clostridium neurotoxins, catalytic domain 0.000000189
Further Details:      
 
Domain Number 2 Region: 545-869
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 3.66e-111
Family Clostridium neurotoxins, "coiled-coil" domain 0.000000176
Further Details:      
 
Domain Number 3 Region: 1072-1223,1252-1280
Classification Level Classification E-value
Superfamily STI-like 5.96e-49
Family Clostridium neurotoxins, C-terminal domain 0.0051
Further Details:      
 
Domain Number 4 Region: 868-1071
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-44
Family Clostridium neurotoxins, the second last domain 0.00000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013720855.1.92526
Sequence length 1280
Comment peptidase M27 [Clostridium botulinum]; AA=GCF_001264545.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=38028-CD; AL=Scaffold; RT=Major
Sequence
MPITINNFNYSDPVDNKNILYLDTHLNTLANEPEKAFRIIGNIWVIPDRFSRDSNPNLNK
PPRVTSPKSGYYDPNYLSTDSEKDTFLKEIIKLFKRINSREIGEELIYRLATDIPFPGNN
NTPINTFDFDVDFNSVDVKTRQGNNWVKTGSINPSVIITGPRENIIDPETSTFKLTNNTF
AAQEGFGALSIISISPRFMLTYSNATNNVGEGRFSKSEFCMDPILILMHELNHAMHNLYG
IAIPNDQRISSVTSNIFYSQYKVKLEYAEIYAFGGPTIDLIPKSARKYFEEKALDYYRSI
AKRLNSITTANPSSFNKYIGEYKQKLIRKYRFVVESSGEVAVDRNKFAELYKELTQIFTE
FNYAKIYNVQNRKIYLSNVYTPVTANILDDNVYDIQNGFNIPKSNLNVLFMGQNLSRNPA
LRKVNPENMLYLFTKFCHKAIDGRSLYNKTLDCRELLVKNTDLPFIGDISDIKTDIFLSK
DINEETEVIDYPDNVSVDQVILSKNTSEHGQLDLLYPIIEGESQVLPGENQVFYDNRTQN
VDYLNSYYYLESQKLSDNVEDFTFTTSIEEALDNSGKVYTYFPKLADKVNTGVQGGLFLM
WANDVVEDFTTNILRKDTLDKISDVSAIIPYIGPALNISNSVRRGNFTEAFAVTGVTILL
EAFQEFTIPALGAFVIYSKVQERNEIIKTIDNCLEQRIKRWKDSYEWMIGTWLSRITTQF
NNISYQMYDSLNYQADAIKDKIDLEYKKYSGSDKENIKSQVENLKNSLDIKISEAMNNIN
KFIRECSVTYLFKNMLPKVIDELNKFDLKTKTELINLIDSHNIILVGEVDRLKAKVNESF
ENTIPFNIFSYTNNSLLKDIINEYFNSINDSKILSLQNKKNALVDTSGYNAEVRLEGDVQ
VNTIYTNDFKLSSSGDKIIVNLNNNILYSAIYENSSVSFWIKISKDLTNSHNEYTIINSI
KQNSGWKLCIRNGNIEWILQDINRKYKSLIFDYSESLSHTGYTNKWFFVTITNNIMGYMK
LYINGELKQSERIEDLNEVKLDKTIVFGIDENIDENQMLWIRDFNIFSKELSNEDINIVY
EGQILRNVIKDYWGNPLKFDTEYYIINDNYIDRYIAPKSNILVLVQYPDRSKLYTGNPIT
IKSVSDKNPYSRILNGDNIMFHMLYNSGKYMIIRDTDTIYAIEGRECSKNCVYALKLQSN
LGNYGIGIFSIKNIVSQNKYCSQIFSSFMKNTMLLADIYKPWRFSFENAYTPVAVTNYET
KLLSTSSFWKFISRDPGWVE
Download sequence
Identical sequences Q9LBS7
gi|331270960|ref|YP_004385671.1|NC_015417 WP_013720855.1.1870 WP_013720855.1.26110 WP_013720855.1.2992 WP_013720855.1.40424 WP_013720855.1.47080 WP_013720855.1.51864 WP_013720855.1.55416 WP_013720855.1.72333 WP_013720855.1.82738 WP_013720855.1.85307 WP_013720855.1.87213 WP_013720855.1.92526 WP_013720855.1.96185 WP_013720855.1.97976 gi|331270960|ref|YP_004385671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]