SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013721000.1.85307 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013721000.1.85307
Domain Number 1 Region: 20-622
Classification Level Classification E-value
Superfamily Anthrax protective antigen 9.15e-183
Family Anthrax protective antigen 0.0000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013721000.1.85307
Sequence length 725
Comment hypothetical protein [Clostridium botulinum]; AA=GCF_000204565.1; RF=representative genome; TAX=929506; STAX=1491; NAME=Clostridium botulinum BKT015925; strain=BKT015925; AL=Complete Genome; RT=Major
Sequence
MLVSKIENSVKDSNKNYFTINGLMGYYFENDFFNLNIISPTLDGNLTFSKEDINSILGDK
SIKSARWIGLIKPSITGEYILSTNSPNCRVELNGEIFNLSLNTSNTVNLIQGNVYDIRIE
QLMSENQLLKNYEGIKLYWETSDIIKEIIPSEVLLKPNYSNTNQKSKFIPNNTLFSNAKL
KANANKDTDSDGIPDEWEVNGYTVMNQKAVAWDDKFAANGYKKYVSNPFKPSTANDPYTD
FEKVSGQIDPSVSTVARDPMISAYPIVGVQMERLVVSKSETITVDSTKSMSKSTSYSSTN
INTVGAEISGNLELAGGIFPVFNMSASANYSHTLENTSTVDNTTGESFSQGLSINTGESA
YINPNIRYYNTGTAPVYNVTPNTTIVIDKQSVATIKGQESLIGDYLNPSGTYPIIGQPPI
ALNTMDQSSSRLIPINYNQLKSIDNGGTVMLSTSQFTGNFAKYNSSGNLVTDGNNWEPYL
GTIKSTTVSLTLSFPDQTTQVAVAVVTPNFSDPEDRTPRLTLEQALVKAFGLEKKNDKFY
FQGIEITENQKIQVFLDNNTNIDFQNQLKNTADKDIMHCIIKRNMNILVKVITFKENISS
INIINDTNFGIQSMTGLSKRSKGQDGIYRASTKSFSFRTKKINHSRGYYKIRFVVQCSSS
FTCNFQLFNNQIFSRSFHEGFFDEFAYFKYDGSNSFLDISCNIIGHSNSGVFLVEVTRIG
DLIQI
Download sequence
Identical sequences WP_013721000.1.85307 gi|331271124|ref|YP_004385833.1|NC_015418 gi|331271124|ref|YP_004385833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]