SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013724592.1.72333 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013724592.1.72333
Domain Number 1 Region: 32-136
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000051
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013724592.1.72333
Sequence length 147
Comment hypothetical protein [Clostridium botulinum]; AA=GCF_001266875.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=55741-CD; AL=Scaffold; RT=Major
Sequence
MNIPNKVIQSLMESGWYSSRNIDISSYEEAYKSEGYKISETIIEFLKKFGGVDIIIPAFR
RHESTDKVYIDPIRAINGVYRGNVLEYEKKIGKSVVVIGETQNEQLVLIMDENGEVYAAF
DDYLAKLGNNIYEALDTFCESKQPIEV
Download sequence
Identical sequences A0A0L7FF28
WP_013724592.1.11614 WP_013724592.1.1870 WP_013724592.1.24327 WP_013724592.1.26110 WP_013724592.1.2992 WP_013724592.1.40424 WP_013724592.1.47080 WP_013724592.1.51864 WP_013724592.1.55416 WP_013724592.1.67530 WP_013724592.1.72333 WP_013724592.1.82738 WP_013724592.1.85307 WP_013724592.1.87213 WP_013724592.1.91623 WP_013724592.1.92526 WP_013724592.1.96185 WP_013724592.1.96458 WP_013724592.1.97976 gi|331268562|ref|YP_004395054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]