SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013736669.1.2613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013736669.1.2613
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.03e-33
Family Pseudouridine synthase II TruB 0.0000389
Further Details:      
 
Domain Number 2 Region: 137-214
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000133
Family PUA domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013736669.1.2613
Sequence length 219
Comment tRNA pseudouridine(55) synthase TruB [Metallosphaera cuprina]; AA=GCF_000204925.1; RF=representative genome; TAX=1006006; STAX=1006005; NAME=Metallosphaera cuprina Ar-4; strain=Ar-4; AL=Complete Genome; RT=Major
Sequence
MEVHCDVNESEIMDVAKTFIGKIYQKPPVRSSVKRRVRKREVYSIDVLEIDKRKVLMRIS
SEPGTYMRKICHDMGILLNCGAHMRELRRVRSGIFKEDTLVTLQQVSEALYLYRNCGEEE
ELRKILMPMEIAFCGVPKIIVDDETVNSISYGSPLMAPGIIAYQDFKKGDYVGLITWKGE
GIAIGKAVIDSKQLGKKGEVVKTERVLMDKDIYPKAWKK
Download sequence
Identical sequences F4FXW9
gi|330833923|ref|YP_004408651.1| WP_013736669.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]