SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013737231.1.2613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013737231.1.2613
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.72e-34
Family GHMP Kinase, N-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 185-311
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.12e-23
Family Mevalonate kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013737231.1.2613
Sequence length 316
Comment mevalonate kinase [Metallosphaera cuprina]; AA=GCF_000204925.1; RF=representative genome; TAX=1006006; STAX=1006005; NAME=Metallosphaera cuprina Ar-4; strain=Ar-4; AL=Complete Genome; RT=Major
Sequence
MRTVEALVPLKLTLFGEHAIVYGEPAIAMAISESMKVTVKESDRTIISSSSLHIGNIRVN
LQDMRVESDQISKALSFVIEALNYFEEKRPALINIESSVDPSVGLGTSAAVIVGVIAAYS
KFLGYDFTNLEIAKISRNVEKKVQGLGSRMDTFTTSLGGILYFPRGSENVERLSSLPEIA
SGYVKRTATTAEILRRVKTVKENGREFNEILKLIGLVVEDARDALDKMDVETLGQLMYIN
HGLLMSLGVTSPILDELVSTARNIGLPGCKMSGGGGGGSAVCLKSPKAELLLESRGFKLV
KSELNRTGVTIKEINS
Download sequence
Identical sequences F4G143
WP_013737231.1.2613 gi|330834489|ref|YP_004409217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]