SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013738467.1.2613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013738467.1.2613
Domain Number 1 Region: 26-182,242-356
Classification Level Classification E-value
Superfamily Pseudouridine synthase 9.06e-45
Family tRNA pseudouridine synthase TruD 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013738467.1.2613
Sequence length 361
Comment tRNA pseudouridine synthase D [Metallosphaera cuprina]; AA=GCF_000204925.1; RF=representative genome; TAX=1006006; STAX=1006005; NAME=Metallosphaera cuprina Ar-4; strain=Ar-4; AL=Complete Genome; RT=Major
Sequence
MHPLDIAIGIEFKVHEWEPLKAEIPRPDGFKVVEEIDRRPCNEWKGVDSGKYAVYLLRKR
GLDHFSVMAKLTKILGERPGYLGIKDANASTEQLIYVRKKRIESYSNSSFSIEFKGFTNQ
KLNHTGNRFEITLVSDEAELTKRVEMIKREGTLPAFIGYQRFGTRRPITHLIGKALSQRD
WCKAVDFILGYPFSEEKKEIKQFRKDYMKRKTDRLQISNVPKQEREVYLELNSSGSCLSA
LKRSPVKLSFYLEAFQSYLFNRVLSRKLINSTTNEKDEIVIHVKPELCDTECKEVFEEEM
VDKNSFLIEELGIRLKPLKRKAFMNISSIELNQELKFSLERGMYATVVLSEILNTDPKSF
T
Download sequence
Identical sequences F4G182
gi|330835725|ref|YP_004410453.1| WP_013738467.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]