SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013776090.1.74519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013776090.1.74519
Domain Number 1 Region: 12-142
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000000000288
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013776090.1.74519
Sequence length 147
Comment prefoldin subunit alpha [Acidianus hospitalis]; AA=GCF_000213215.1; RF=representative genome; TAX=933801; STAX=563177; NAME=Acidianus hospitalis W1; strain=W1; AL=Complete Genome; RT=Major
Sequence
MSDQQENKVVISLDDLLAQAQLLKKQIDDLSAARAELLDSVASIEAAKASIQELKSQQEM
LVSSDKKGYLMFKINNQPPQKVLVYLGLSYYVEVDMDTALKILDDRENELKEASTGLDKK
LAESKAAYDQIVDILNQIQAQAQQKGE
Download sequence
Identical sequences F4B466
gi|332796972|ref|YP_004458472.1| WP_013776090.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]