SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013864475.1.71618 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013864475.1.71618
Domain Number 1 Region: 3-389
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 6.57e-66
Family Gtf glycosyltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013864475.1.71618
Sequence length 408
Comment glycosyl transferase [Microlunatus phosphovorus]; AA=GCF_000270245.1; RF=representative genome; TAX=1032480; STAX=29405; NAME=Microlunatus phosphovorus NM-1; strain=NM-1; AL=Complete Genome; RT=Major
Sequence
MIMRILVSTTANVGHFEPLLGIARACRDAGHEVRVAAPRSFDATVARTGFPFQPFDDAPP
ELIGPVMSRLPELSFEEANATVVREVFGRIDAQAALPALAAAVEAWRPDVIVREPAELGS
LAVAERAGIPQIQVAIGMAEMVRLFAGQLVEPLTDLATMAGLPDDSLNRALAGVPTLSSV
PEVLDRAGDVAFSDDAVTYRFREDPPAPAATPLPQWGDPGLPLVYVTFGSVTGSLPPFAG
VFRQALDGLADLPVRVLMTVGRQVSITDLGPVPANARVEPWWPQTDVLAEAALVLGHGGY
GTTMGAITAGVPQVVAPIFTTDQAVNARHIAAVGAGRAVSPGPDVVVRACQEVQSVLEDP
SYRHRAAVVAAAIAALPSTADTVAVIRRIAGITTSRVRAGIPARPHAQ
Download sequence
Identical sequences F5XNY6
gi|336119252|ref|YP_004574029.1| WP_013864475.1.71618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]