SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013889689.1.34921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013889689.1.34921
Domain Number - Region: 204-381
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0068
Family Pentapeptide repeats 0.011
Further Details:      
 
Domain Number - Region: 30-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0785
Family BAR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013889689.1.34921
Sequence length 404
Comment BspA family leucine-rich repeat surface protein [Helicobacter bizzozeronii]; AA=GCF_000237285.1; RF=representative genome; TAX=1002804; STAX=56877; NAME=Helicobacter bizzozeronii CIII-1; strain=CIII-1; AL=Chromosome; RT=Major
Sequence
MQEVLEKLEQEIKSVKRACRLGKSVLEEGLEVKTEAQELHAKFSALIEALTHASKAVDEH
YASLEDDTALEEMLILLKRVRARINTPLASLEQASTAKEALDSLASLEKSILDVEGVLAS
LKEHPTLSTPTSPKATPQMAKKYCPQSKEELKKLVADESVHLGEIDISKIADLSWVFCYA
DSILAAEPKVFRRANFEGLETWDTSHVTNMEYMFYRAIFFNYDISSWNVSRVQNMDSMFH
GCEIFNQPLSSWNVSRVEKMAGMFLGCENFNQPLNTWDVSRVEAMGWMFQHCEDFNQPLD
NWDVSRVENMNYMFHGCTSFDQPLKDWNVSRVEEMHSMFKDCKNFNQSLNDWDVSKVKSM
RHMFSNCYNFNQNLDSWHVLSTASTKSMFDGCTALKTLPTWYKN
Download sequence
Identical sequences F8KQ01
gi|336452430|ref|YP_004606896.1| WP_013889689.1.34921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]