SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013891000.1.34921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013891000.1.34921
Domain Number 1 Region: 283-487
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.66e-25
Family ABC transporter ATPase domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 663-738
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000275
Family Smr domain 0.011
Further Details:      
 
Domain Number 3 Region: 67-267
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000000589
Family DNA repair protein MutS, domain III 0.015
Further Details:      
 
Weak hits

Sequence:  WP_013891000.1.34921
Domain Number - Region: 476-566
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0282
Family IMD domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013891000.1.34921
Sequence length 739
Comment endonuclease MutS2 [Helicobacter bizzozeronii]; AA=GCF_000237285.1; RF=representative genome; TAX=1002804; STAX=56877; NAME=Helicobacter bizzozeronii CIII-1; strain=CIII-1; AL=Chromosome; RT=Major
Sequence
MSLIAQLDLTRFIEHFSTFLARPKDFAPSHTPPNIWEHLQELEHLDCTPPPALICLKDAL
KAFKKGGVWRLDTLFAFVQITRYFAYLKALASPKQHPHLYAYLDNIHFPPALLELSTHMQ
DTPTLKSGFYPDLDALSESLARLQAQQKKLLNQILNKSGLQSYLVDRQVHFVNGIESLLV
KPGFSVAIKGQVILRSHMGYFYIEPLEARDLSRKIQEVQTKIEENLARICTHWSGLLRPH
FLFLRFINHEFDYIDHIIARVQFAKSANLSFIKPNNRGDFTLSHFAHPNLNNPKPISLRF
DRSLLLITGVNTGGKTMLLKSILSAVFLAKHFLPFKIHAPTSAIPYIEHIQAIINDPQNS
QNDISTFAGRMLDFQRALNTPQLLLGVDEIELGTDASEASCLYKVLLEKLMTQGAKIVVT
THHKHLALLLAKNHAIQLLAAHFDPQAQLPTYTFSPGLIGKSYAFESALRYGVPLEIINQ
ARALYGAEQENLNALIERTSALEQELRVQHAQLEEAKKAHSQQIQEELEQLQAKAQAQQA
KQNALEKSYQQALRALQDALKEFERTQNKSHAHQQIQAIKASLTQPKPTPKTTTNPPALT
QGACVRYKNQLGSIISLNKESCLVALDNGLKIKINAQELTLATPPKIPPQVKLERKPTAQ
ASMRLDVRALEVLEALQQAQDFLANALLAGFEEVLIVHGKGKGILRQALREWLKKHPKVI
AFEDAPYNLGGSGAQVVKI
Download sequence
Identical sequences F8KP97
gi|336453853|ref|YP_004608319.1| WP_013891000.1.34921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]