SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013932777.1.44118 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013932777.1.44118
Domain Number 1 Region: 43-139
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000115
Family FCH domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013932777.1.44118
Sequence length 184
Comment hypothetical protein [Pseudothermotoga thermarum]; AA=GCF_000217815.1; RF=representative genome; TAX=688269; STAX=119394; NAME=Pseudothermotoga thermarum DSM 5069; strain=DSM 5069; AL=Complete Genome; RT=Major
Sequence
MKKFLAILLVVILASTVVLAAPMMKVKSFGPGYGPVKPWFGWQAREELRFQEKEQLKERA
RETLKEMYKKAFETGKLTKEQAQQILNIINEAKEKLNALQKEFEELRQKASKMTLNEYRN
AVRELNQKRAEITKEAAQKIGDIVTVEQLELLRSQLRFTFKKCYVPTLNFFDEVILKALE
EYAK
Download sequence
Identical sequences F7YTY3
gi|338731269|ref|YP_004660661.1| WP_013932777.1.44118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]